PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_DD8261917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 103aa    MW: 11754.7 Da    PI: 10.3897
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_DD8261917.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.72.1e-121461055
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                           + +NRe+ArrsR+RK a++  Le  v++L++e  +L k+l e +++
  Traes_7AL_DD8261917.1  1 MVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 46
                           579**********************************777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579592.04E-9147No hitNo description
PROSITE profilePS502179.22146IPR004827Basic-leucine zipper domain
PfamPF001702.2E-9146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-10247No hitNo description
SMARTSM003381.6E-4356IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MVSNRESARR SRRRKHAQLT DLELQVEQLK SESATLFKQL TEANQQFTTA VTDNRILKSD  60
VETLRIKVKM AEDMVARGAV SCGLGQXXXX XXXXXXXDVT KPW
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3613381e-104AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02.
GenBankAK3632571e-104AK363257.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013M10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625526.15e-44PREDICTED: basic leucine zipper 9 isoform X1
SwissprotQ9FUD31e-32BZIP9_ARATH; Basic leucine zipper 9
TrEMBLW5HBE05e-60W5HBE0_WHEAT; Uncharacterized protein
STRINGMLOC_58027.41e-52(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.14e-25basic leucine zipper 9
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]